PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 228aa    MW: 26128.2 Da    PI: 8.8158
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520203.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.74e-1196140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       W++ E++l++ + +++G+g+W++I+r +  ++t+ q+ s+ qk+
   XP_010520203.1  96 VWSAYEHKLFLIGLERYGKGDWRSISRNVVVTKTAAQVASHAQKF 140
                      6******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.62253IPR001005SANT/Myb domain
SuperFamilySSF466893.52E-7458IPR009057Homeodomain-like
PROSITE profilePS5129412.26489145IPR017930Myb domain
SuperFamilySSF466894.24E-1391146IPR009057Homeodomain-like
SMARTSM007174.4E-493143IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.9E-1495144IPR006447Myb domain, plants
PfamPF002491.6E-896139IPR001005SANT/Myb domain
CDDcd001672.87E-597141No hitNo description
Gene3DG3DSA:1.10.10.601.2E-697136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAANPWTRAE DMVLEDALAT FSGSLWDRLQ RIADILQRPL SDVYEHYRAL VRDISEIGSG  60
RVSTPNYYDH DRAESSGSQV AATAPPAKRK KNDWEVWSAY EHKLFLIGLE RYGKGDWRSI  120
SRNVVVTKTA AQVASHAQKF FIRQEKAAEG RKRPSIHDDN TVDMDLVAKL FPQWLDAFQT  180
QTQTQTQTQT QTQIGQTQTQ IGQQQLQTRI WQPLSQLPVQ QQFIQERG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520203.11e-168PREDICTED: transcription factor DIVARICATA-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-49MYB family protein